PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G15530.1
Common NameLOC102715448
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARR-B
Protein Properties Length: 624aa    MW: 67996.7 Da    PI: 6.4664
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G15530.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.37.2e-28212265155
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   kpr++W+ eLH++Fv av+qL G+ekA+Pk+il+lm+v+ +t+e+v+SHLQkYRl
  OB02G15530.1 212 KPRVVWSVELHRKFVAAVNQL-GIEKAVPKKILDLMNVENITRENVASHLQKYRL 265
                   79*******************.********************************8 PP

2Response_reg78.91.7e-26301381109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ +++l+++l + +y +v+++ ++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+ge +++ + +  Ga 
  OB02G15530.1  30 VLAVDDDPTCLKILENLLLRCQY-HVTTTGQAATALKLLRENKdqFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGETQTVMKGITHGAC 124
                   799********************.***************888889*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+  e+l++
  OB02G15530.1 125 DYLLKPVRLEQLRT 138
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.6E-1951624IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23003.2E-4227168No hitNo description
SuperFamilySSF521721.85E-3527151IPR011006CheY-like superfamily
SMARTSM004481.8E-3228140IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.42529144IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-2330139IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.19E-2731144No hitNo description
PROSITE profilePS5129410.912209268IPR017930Myb domain
SuperFamilySSF466891.24E-19209269IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-29210270IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-24212265IPR006447Myb domain, plants
PfamPF002493.8E-6214264IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MTVEERQGRV NGHGSGGGGG RDQFPVGMRV LAVDDDPTCL KILENLLLRC QYHVTTTGQA  60
ATALKLLREN KDQFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSANG ETQTVMKGIT  120
HGACDYLLKP VRLEQLRTIW QHVIRRRNCD AKNRGNDDDA GQKAQGLNNE GDSNGANRNK  180
RQSRKGRDEN GDDGDDSDEN SNENADSSTQ KKPRVVWSVE LHRKFVAAVN QLGIEKAVPK  240
KILDLMNVEN ITRENVASHL QKYRLYLKRL STDASRQANL AAAFGGRNPA YINMNSFGNY  300
NAYGRYRPSA GHTPANNILT RMNSPSAFGV HGLLPSQPIQ LGHAQNNLST SLNDLGGLNN  360
GNMIRGAQMS TILTGPSGNS FPNMSNGAPL STANRSLQPL ESSNQQHLSR VHSSSADPFG  420
ALGESPQFPD LGRTTATWQT AVPSNIQDRG HNDSMSQTTL HMNGPKVEPV SSFTASSNQI  480
PLLGNEMQSQ VASLATNVPI AFTQEASPFT YGSSTNSRDM LNNSHVFSNS SIINASLPNL  540
RIDNPAVPRQ TLDGGNMGIV PPMQDGRIHH QAVANQLNYS DDLMRTTGLQ RGLSGGLDDI  600
VVDMFRLERD DDGVPFIDGD WELV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-26208271164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1005300.0AK100530.1 Oryza sativa Japonica Group cDNA clone:J023101H04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646983.10.0PREDICTED: two-component response regulator ORR24
SwissprotQ6H8050.0ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLJ3LA860.0J3LA86_ORYBR; Uncharacterized protein
STRINGOB02G15530.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-115response regulator 12